PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_022795-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family BES1
Protein Properties Length: 327aa    MW: 34770.6 Da    PI: 8.2733
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_022795-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822217.33.4e-6721471150
         DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqs 96 
                    ++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++++g sasasp+ss+q 
  NNU_022795-RA   2 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPVERMDVVGGSASASPCSSYQ- 96 
                    5899*******************************************************************************************. PP

         DUF822  97 slkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvsssl 150
                           +sp++sy++sp++ssfpsp+s++ + +a+a    +sl+p+l++ls+vsss+
  NNU_022795-RA  97 -------PSPCASYNPSPATSSFPSPASSSYAANANAngdgNSLIPWLKNLSSVSSSA 147
                    .......********************99998888778999************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056879.5E-683141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPVERM DVVGGSASAS PCSSYQPSPC ASYNPSPATS SFPSPASSSY  120
AANANANGDG NSLIPWLKNL SSVSSSASSK LPHHLYITGG SISAPVTPPL SSPTARTPRI  180
KTDWDDPTAG PTWPGQHYSF LPSSTPPSPG RQIVSDSGWL AGIRIPQGGP SSPTFSLVSS  240
NPFGFKEEVL AGGGSRMWTP GQSGTCSPAV AGGSDQTADV PMSDRISDEF AFGSNATGLV  300
KPWEGERIHE ECGSDDLELT LGTSRTR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010242162.10.0PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV881e-145BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A067GE961e-175A0A067GE96_CITSI; Uncharacterized protein
TrEMBLV4W9571e-175V4W957_9R
STRINGVIT_10s0003g01790.t011e-173(Vitis vinifera)
STRINGVIT_19s0014g00870.t011e-164(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-132BES1/BZR1 homolog 4